PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00265g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 371aa    MW: 40895.9 Da    PI: 6.1888
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00265g00015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.96.2e-30129182155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Peaxi162Scf00265g00015.1 129 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 182
                               59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.423124185IPR017930Myb domain
SuperFamilySSF466892.69E-19127186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-30128187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23130182IPR006447Myb domain, plants
PfamPF002496.9E-8132181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGEEVKITDC DVNGDADADD RVLEWEDGLP SFDDLTPLSQ PLIPPELASA FRISPEPTKT  60
MVDVNRASEN TFSSLQQQLH ILSNFETPDV SESRKTRRID PANEEADSAS GGGDDNNNNN  120
NSGNKALKRP RLVWTPQLHK RFVDVVAHLG IKNAVPKTIM QLMNVEGLTR ENVASHLQKY  180
RLYLKRMQGL SNEGPSSSDH LFASTPVPHS LQESASGNGN GHNNNNNNNN TSSNGGHMPM  240
PMPMPMMYPP QMMPMPMIGM SGHGVHMPSP GFHHHQYNMG AQQRDWSDNK FAPYHHVRLL  300
DLSIRNLTLV DCKLGIPVIL ESRLMKVSNV VLAVPLPISG EMEFQSGHAT IQDGRDSTQT  360
LNPAYASLSS P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-20126187263ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774339.11e-122PREDICTED: transcription factor BOA-like
RefseqXP_016437169.11e-122PREDICTED: transcription factor BOA-like
RefseqXP_016503348.11e-122PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-78PCL1_ARATH; Transcription factor LUX
TrEMBLQ4H2B31e-117Q4H2B3_NICBE; NbPCL1 protein
STRINGPGSC0003DMT4000054901e-110(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-74G2-like family protein